NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209494_1023086

Scaffold Ga0209494_1023086


Overview

Basic Information
Taxon OID3300025673 Open in IMG/M
Scaffold IDGa0209494_1023086 Open in IMG/M
Source Dataset NameMethane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2237
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Source Dataset Sampling Location
Location NameHudson Canyon
CoordinatesLat. (o)39.55Long. (o)-72.4Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059362Metagenome / Metatranscriptome134Y
F090619Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0209494_10230862F059362AGGMMSRSHYLSGVIKTGEPFLVEDDVKLRKTATIEGNIGKIVRVGTMNDHESVYDIGSLISIDDVSLVIRSFRSGDLVAYDLNGTNSSVYKDIKVTKLLKKQDISVLFQND
Ga0209494_10230866F090619GGAMTSEKYIQIRTKIPINSDGTVFKEFNANEKFRRQDVSVMLRLLPLIAKYELEFLPKIVEYNEDGYTYEFVEGQTLKEEIDNGVLKLTQKMILEMKIAMDDIWKKFYEISIENKDDELFEGTRFLYHGDPWLGNVIWNDDTKEFKFIDIDSLSIADFVPLTQLNNMFFQHLETLLVTQWPNGQNKNQSTLGTWI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.