 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300025674 Open in IMG/M |
| Scaffold ID | Ga0208162_1000631 Open in IMG/M |
| Source Dataset Name | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 19651 |
| Total Scaffold Genes | 26 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 20 (76.92%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Chesapeake Bay | |||||||
| Coordinates | Lat. (o) | 38.9819 | Long. (o) | -76.3716 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043947 | Metagenome / Metatranscriptome | 155 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208162_100063118 | F043947 | GGAG | MPTYSHDLTITPRIRVGTETLGDGSVQTDCISAVVCIAKCTDTDTGEVASTDPWVSLDLSSLTADDYVALDALTGLPQRAIDQLTAWGEEQQAGLEAQLQARASAPKEQTAPWSASNA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |