NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209652_1060684

Scaffold Ga0209652_1060684


Overview

Basic Information
Taxon OID3300025684 Open in IMG/M
Scaffold IDGa0209652_1060684 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1279
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002188Metagenome / Metatranscriptome585Y
F003777Metagenome / Metatranscriptome469Y
F084241Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0209652_10606841F084241N/AKFDNELTHKKSFSPKKVVWGMEFDMTGGTGTQSATTQRLYNEYSDIIDFMSVRGSQQSTYVDSQTMKLTNVKLPKLPPELNGTFNLDDWFRVYINGVYIPPTKYTYSYDYNTNEITFIIDTSSPASSTSLGYILENTDEIGVTGKFIEL
Ga0209652_10606842F002188GGAMIKDLQKLLKQVHEPDEYQLVPHNMSHPTYWIWKIENAKMKDLDVKLRPFRNEHARFDIFINGQFILEKDYTTEQSGKDFHVKFIKANFAGAYNLEIDDEIKLEGDIDLV
Ga0209652_10606843F003777GGAGMSKVQPSIVTPFNDKQRFKNLVLEVINDTSIFTLIPDSISLNGVLFTLTLSNKKFVFEEIKVDGLSDYIDVYLQGIKRPSDNYSVTDNGSDIIITFTESIALVPAEIVRTDFSVKGKIVS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.