NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209602_1003101

Scaffold Ga0209602_1003101


Overview

Basic Information
Taxon OID3300025704 Open in IMG/M
Scaffold IDGa0209602_1003101 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13003
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (15.79%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040660Metagenome / Metatranscriptome161N
F095514Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0209602_100310111F095514N/AMKRILLTLSILYSFYGWSQNAAIAVPHAFQGTHFKTFKEQGETIRTWYEISGRYSEDYMEVIRRIYQPNRDQTLRILDTYGDEGYTAVKIESRGWIYILIQSNAGISESKIQAREKEPRD
Ga0209602_100310115F040660GAGGMIISKLLYQRCVEGGRYNWQKIKEKRSIWNQAKPLKKEIGKEAYWAKKAIGTFQKEAQGAPMDISILPIDCVNRCPSGHLLHRLGLRRNPFILLAFHENAFLLADLRSATCTRQESWKGLIYGFDGVLIWDLYEDVTEKSLGLIYRKKSVLTGGGGVNDGGY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.