NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209746_1009103

Scaffold Ga0209746_1009103


Overview

Basic Information
Taxon OID3300025716 Open in IMG/M
Scaffold IDGa0209746_1009103 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4081
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Saccharicrinis → Saccharicrinis carchari(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow, Alaska, USA
CoordinatesLat. (o)71.290565Long. (o)-156.788622Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014212Metagenome265Y
F066627Metagenome126N

Sequences

Protein IDFamilyRBSSequence
Ga0209746_10091031F014212N/AMKIRLILAFLILSVSSGAQLIHVEGSKALGINYAYVKNGFNVSSRITFYKNNNLAFRGSIDFERVRFDLSKASIVYANPELMYTFYNPGNKLFFNIKGGILTGVEFISNSILDKKKSQFFVGENLGLCAEYFISNKIMLNLDLDQRFFQM
Ga0209746_10091038F066627N/AKINRKVANYHNLELAIAQVSDSYTRVLGSLKAIDEHNCFKPSEYHMLSESMMGLLSQTSYSITTLTVVLTDNFSEMSDGERLLNMNQAIKELRENLGVINSAIIEVEILDNQRMQLRTLNYINSIFK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.