NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209606_1201037

Scaffold Ga0209606_1201037


Overview

Basic Information
Taxon OID3300025730 Open in IMG/M
Scaffold IDGa0209606_1201037 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)642
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)41.53Long. (o)-90.43Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011593Metagenome / Metatranscriptome289Y
F078878Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0209606_12010371F011593N/ANGLTAPEWCLGCPYPIYDDRRGEWDWYCRQHSPTGIRCSNVAVLRERCYRVREYFSNLEVTL
Ga0209606_12010372F078878GGAGGLSGTLVLKIPYESTSFQAALTDATLRDRVLEWTTAAVMLDDAVYIPLRTDWVPPRDRRTADGIEALVDGGRPDQWPQEVRAAIEAGRFARASGRIVAEFWKGIATCGLSGVNEEQTENEVPEDAPVVIRIHATPVNHVDGWSWSHVVTEIRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.