NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208784_1002692

Scaffold Ga0208784_1002692


Overview

Basic Information
Taxon OID3300025732 Open in IMG/M
Scaffold IDGa0208784_1002692 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6981
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (85.71%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Associated Families5

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001059Metagenome / Metatranscriptome790Y
F001915Metagenome / Metatranscriptome617Y
F006264Metagenome / Metatranscriptome377Y
F027490Metagenome / Metatranscriptome194Y
F031403Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0208784_100269210F027490GAGGMSGYGKVINGGGKMSKGLTKGINDKLSTRTSEHSRREKVAVAVRDVYKVNTLSDQHTQNINGGKFQKGTRPSKV
Ga0208784_100269211F001059AGGMATYDIDALKADLPTAKELAQFVYDRTQIALDLVGKPKEEQYLVARNALEGKKIPVEYMTEDNPYVDKTNTIPKDPIPPLPPRGKELPPEEAEIHHFGATNMPHPLNPQSDRKVHIMFRKYNNNVVTFQVMGPMHYEEEGRRVNKYGQEVPERYKLVDPRTAETVLRNADGTFTERGLRMYTYCSGEKGAGIWTLIDKSLASSSTKNIADPWS
Ga0208784_100269212F006264N/AMEDFASIFRQKLSNQAEACARKTLERLQKDLQGPQELQPQDVFYLSKAADILLAIRDSYGTK
Ga0208784_100269214F031403AGGAMLDKQNIVVDGLESPPANKGIEYQVAHEAYLKMVDYLRLTQAKNTLNRLSDYHYLNIAVSNSTEPVRGIDYISPVVSPGIDYSTAVITKCLMPNGKLNFEFERLSEADVAGSQQAAKMALHFINSKN
Ga0208784_10026926F001915GGAMEWSLAHPLHDIEDMVELGDTVYGSDVEGILKRDKGIFRHRLTVACTEQLFNKGKEFIAVCRADGEVVPFYDENNRLVGHDTVRQLLGFCWFDRGGYTSYCNDEISNSKFHSVDLSLPLRTRLKLVNQMIDQHILWAYKNGIPIICSTSIRADHDGFMKIHKKRGFTVNGSYAWIRTEEAMKCLTNQLENRK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.