NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207997_1006489

Scaffold Ga0207997_1006489


Overview

Basic Information
Taxon OID3300025736 Open in IMG/M
Scaffold IDGa0207997_1006489 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKN (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5423
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAce Lake, Antarctica
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075591Metagenome / Metatranscriptome118Y
F078142Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0207997_10064894F078142GGAMSFEIEAFNSIYASITIAQCQIRIGRTVIAKALCAGIGTLRENTDEGQLGSIDANVRLLAADEPDGEIKTGTVIEILQNGQDEKTGWVKARVGGRFPVGGLTRLALEAVNE
Ga0207997_10064898F075591AGGAMQDLAKLSELAEAEIETLRADGIDLTPAEIVEINALGWAVESPETRRLLARGAPVAIGGVYLWPMSLYAQDWFDRVGCQLDGNKQQTYALAYAMAHGRDAGEPLAMEGREAEKTVKQWGKSLKCTFGELNVAISQVLAQDEDAEQPPSETGGMTMGDFSAFLAAACGGDPDFWERRCASGYTHAVLDTLVRQNSADGKKTMADPRLKAERAIGWAVEKIKKSRKEPK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.