Scaffold Ga0209747_1014491

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209747_1014491

Scaffold Ga0209747_1014491

Overview

Basic Information
Taxon OID	3300025750 Open in IMG/M
Scaffold ID	Ga0209747_1014491 Open in IMG/M
Source Dataset Name	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3343
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Caldiserica/Cryosericota group → Candidatus Cryosericota → Candidatus Cryosericia → Candidatus Cryosericales → Candidatus Cryosericaceae → Candidatus Cryosericum	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location Name	Barrow, Alaska, USA
Coordinates	Lat. (^o)	71.290565	Long. (^o)	-156.788622	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040026	Metagenome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209747_10144913	F040026	AGGAGG	MASSSNGSGFFFLQSAYLNILEDQGILSPETALPLDEIDSLINPFVRFGGFGQGWIVVNKLLRYGVLRTSPDDRYYLDQEAAENFRYSFARWLPW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.