NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208150_1007156

Scaffold Ga0208150_1007156


Overview

Basic Information
Taxon OID3300025751 Open in IMG/M
Scaffold IDGa0208150_1007156 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4098
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001873Metagenome623Y
F022638Metagenome213N

Sequences

Protein IDFamilyRBSSequence
Ga0208150_10071561F022638N/AYTEDAWDVNDGTDNWHLGVGEAGYIYGTVTGNVVGEPRQKLAPPSAGPSELRTDQGFNTRRIQFASFTPSGSAANGLAVTWYWPPGFRSGGTTEWRLGWDEPGAATLYTSWLAWDATEAQIEAAIIGALGENTEGIYSNVNLWALGKTQPDNTCAAYEAGLYIQFLTSPDPDNNPFGFVDSRRLTAVRDRHRIEFRNYEEQAPHSVAAWSTADGSVTWSRHYGYVGAQPITWLRRAWCDGGSWVWLAGPVVDPD
Ga0208150_10071568F001873N/AMRIDEMKWWNVLTMLVVLAGGADAEILMMSHDFTEFQHPFWATEADGKGDLIQWDLTDKCGGGSVWLNADGFFNNHLDRQYTAHGYRYGIKRIPGAPVDDISDFITNDWIQHHRDGALEFGGNDSRGMVEFYAEQDISLQPGFLTVTLSNDREFAIWKFNGRVVYTHESGENNLQTFKIDIPDGLDQMRFEFSGSGTADGVIEHIEYHKYSTVPEPSLGDLIDLIGSGVGGLIGW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.