NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208386_1021701

Scaffold Ga0208386_1021701


Overview

Basic Information
Taxon OID3300025781 Open in IMG/M
Scaffold IDGa0208386_1021701 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)974
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008991Metagenome / Metatranscriptome324N
F010534Metagenome / Metatranscriptome302N

Sequences

Protein IDFamilyRBSSequence
Ga0208386_10217012F010534AGAAGGMSDKVGEKQEAIMNLIDQQIKGALKDQASRLEILQDRIKDAIDISTTEHSQGIKQVMLFVTKAHVQAWITSLKHKVDTAGDCEICDLEKILGEESLEIAEAVKVALSNRNEETRNRILGELLEKTITKIEALSVRAPQVPQP
Ga0208386_10217013F008991N/AMNLTVKITEQVEKKLETVLRGKYDNRTIWMYYKVSLQMLRDILEDLIACHHTTHSLAEKDLYYEQNKVQIVDWIQWIQNRTSSDKLVDLDRLLSKLIKDKAENLVEALTEENPSDRMTTLSMLQMSIQIALFMETQQLLRSPTV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.