NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209199_1017864

Scaffold Ga0209199_1017864


Overview

Basic Information
Taxon OID3300025809 Open in IMG/M
Scaffold IDGa0209199_1017864 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4592
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070557Metagenome / Metatranscriptome123N
F090391Metagenome108N

Sequences

Protein IDFamilyRBSSequence
Ga0209199_10178646F070557GAGGMSNEIKQNIIRDLQGDILSGDHYTINMFSCWLDGSYLGESHYRKNLAAITECNNNRKKLRSFVINAFTSYIAHDAACSYGYAQKVLVDFLGLDTLNKLNEQLIDNVIEFHSTYCEAA
Ga0209199_10178648F090391N/AMLKDTVKIKRDTLEQLTDFVRKDIEVAHLETSDNEDLTYIINVTNALMAGKYSLELYKNENHVFIEIDQLEFLTEHTQDSFDFIAPDTDWNCLSDMLATNLLASAILEARQAMQIEPETKEEQNE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.