Scaffold Ga0209099_1000327

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209099_1000327

Scaffold Ga0209099_1000327

Overview

Basic Information
Taxon OID	3300025858 Open in IMG/M
Scaffold ID	Ga0209099_1000327 Open in IMG/M
Source Dataset Name	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	56979
Total Scaffold Genes	68 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	49 (72.06%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula → Methanoregula formicica	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location Name	Japan
Coordinates	Lat. (^o)	35.92	Long. (^o)	139.63	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083634	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209099_100032766	F083634	N/A	MLKLANQVIVLDRLNINGRLHRLSRELQITVGHTEDRLTLSNDEFGLLVSAPTLEEGIAGISDELSMLWEVYVADNPAHLTKDALRLRSNLKSLVAAGAGS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.