NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209632_10295082

Scaffold Ga0209632_10295082


Overview

Basic Information
Taxon OID3300025886 Open in IMG/M
Scaffold IDGa0209632_10295082 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)810
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005707Metagenome / Metatranscriptome392Y
F008221Metagenome / Metatranscriptome337Y

Sequences

Protein IDFamilyRBSSequence
Ga0209632_102950821F008221AGAAGMAITATKLSDNDFNIIVKANGVGSEDEQTLVDVVNSDNATSEPKVSIADIHYEVLGTGKCTIFFKNDIEKKVEITGRGNYGLKPTEDRIKDAIGDILLTSDSNVTSYNVVIEAQKESGYT
Ga0209632_102950822F005707AGGAGMAQTFIAKGNIVTNPSDNDFDRAVFVRITATADVTGILELANGSTKIGEFYLEDGNTIILEKHPEEKITCGTSKASAVGSPRS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.