NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209631_10221627

Scaffold Ga0209631_10221627


Overview

Basic Information
Taxon OID3300025890 Open in IMG/M
Scaffold IDGa0209631_10221627 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)960
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051153Metagenome / Metatranscriptome144N

Sequences

Protein IDFamilyRBSSequence
Ga0209631_102216273F051153N/ANPKPTVSSVHHELLRHETECSERWRTNFKQLDKLEASITRMMWWMIGGLTTIGASLLTLTLRTLFV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.