NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209567_10071789

Scaffold Ga0209567_10071789


Overview

Basic Information
Taxon OID3300025895 Open in IMG/M
Scaffold IDGa0209567_10071789 Open in IMG/M
Source Dataset NamePelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1604
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, North Sea, Atlantic Ocean
CoordinatesLat. (o)53.9944Long. (o)6.8905Alt. (m)Depth (m)29
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049003Metagenome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0209567_100717891F049003N/AWSHGLRAYPKPVTRAKVRSVTDASDNRAVLKRWLLDRLTEGARPKKEWRELWEATWDYVLATPVHDLIDANTAKTLADRLVDPQLVTDLSRPIVAAVSRVVIAELRQDEQPVDRFLPPEAQDKLHEALARPGLVHPDWVRAMFRGEAAEAVLSDALYRALKDFSTLLPRLLVKISPMGRLGVLGGAGALAERLIEELEKLIEPEIKSFLADSTERVLERAAEFTIAKIDDPASIEFRSKFVSFVLSKSPAFFLEAADDELIGDIGAVVELTARHLAEAPEIRAGIHVWIDRAMAYSTDKNLGQLLQLEGSGVRPPIDAMADATWPAFKTVLASPQAQTWMDTLLDELLDEYERIAD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.