Scaffold Ga0208916_10003300

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208916_10003300

Scaffold Ga0208916_10003300

Overview

Basic Information
Taxon OID	3300025896 Open in IMG/M
Scaffold ID	Ga0208916_10003300 Open in IMG/M
Source Dataset Name	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6485
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (10.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location Name	USA: Delaware Bay
Coordinates	Lat. (^o)	39.283	Long. (^o)	-75.3633	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039135	Metagenome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208916_100033008	F039135	N/A	MKYLKKYTTYKESIMVDLMFQNMVELLESLTIWHDALLSSIAAEEVDIYETFHLPVEEYKDKLDLDFLEDHVEFINSLSSLALKKSTLEHSDSYETFLNKPCKFMFIYGINRNELENPEYLLFQSWQETLEKWDDVKLYKVNENIQRFYDKLSSRVLELIDGGDKYIYKTSNGNEWILQNTDNENDTYKKTFRKTELEDLLRDNKIKVNII

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.