NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209425_10025008

Scaffold Ga0209425_10025008


Overview

Basic Information
Taxon OID3300025897 Open in IMG/M
Scaffold IDGa0209425_10025008 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4550
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (35.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043289Metagenome / Metatranscriptome156Y
F057993Metagenome / Metatranscriptome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0209425_100250085F043289N/AMKITIEHYEEKVTYESKHDSMGMTVLTEKLYGLCVAAGYHPDSVGKCFFEKGREMTEHLYPDDKMEEEDAMCYLREGETISILSRYNEERKFTIIAKDCIEYSFKDDGHVGCSRNDDGSLHSVDPSGGPYIAVGTNLGDVHKDLDGLIVTKIKRSDYKSGSYYLTVKDYEYKAPAWVNWP
Ga0209425_100250088F057993N/AMMRYKDVEFRPATVDRRAEIVAWTYSESLDRETCITLCWIMQDNEGCYMRTIGNRYVEYEDMEALNHVAKYAMRSLNVQFEFEEKL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.