NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207654_10000013

Scaffold Ga0207654_10000013


Overview

Basic Information
Taxon OID3300025911 Open in IMG/M
Scaffold IDGa0207654_10000013 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)241873
Total Scaffold Genes195 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)162 (83.08%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002998Metagenome / Metatranscriptome514Y
F010204Metagenome / Metatranscriptome307Y
F104359Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0207654_10000013116F002998AGGAMAVSANRVWRQLPEETRVASCRIFWAEAKGTEKQLLFATLAKARNLREVFVRKSPTERLVNWTAATLSLPEHIVDDLLKQYLLHEHRAVIVTFLDLLKIPHSEGMIEPEFDLATLTNEHVQEATRSLLASADRAGSELYLKYLVLQGGPWAGIEEVLPAGE
Ga0207654_10000013146F104359GAGGMSRFPHTFLDMTHSDQPHSETLQRLMDLGYIAGKRITLYGEHFEIASDPFIDGNWVAVRVTSEYDPTIQTIRLPISLLLGLTNVIPAT
Ga0207654_10000013149F010204AGGAGGMRCFWEQIGVLGPIYRLLGSGIDNDDIASRLHLTEEHVQGCISWLIHFLKLKNRRELAVYAAAGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.