 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300025922 Open in IMG/M |
| Scaffold ID | Ga0207646_10013415 Open in IMG/M |
| Source Dataset Name | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7837 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan: Kellogg Biological Station | |||||||
| Coordinates | Lat. (o) | 42.3948 | Long. (o) | -85.3738 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006137 | Metagenome / Metatranscriptome | 380 | Y |
| F010988 | Metagenome / Metatranscriptome | 296 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207646_100134154 | F010988 | AGGAG | MNRMNRREFLSVLGGASAVSMVGVSAFAATSADKVTADITSLYVKGLVMLDLGNPEVVRLGFPKAPGHKATLSIVPQNGTRRTMAIKGNGSVEATEIASADPKIFVPELVRMKEFYGNSVKSHVDKCPSVISIPCNAIRSIKTSEVSQARYTFVRADNGEEVTGFRPRQVAETIKIDLSSTGTLKLDDGKVNIPLEGARELRVEYTPEKVEPGFDAYADHFGHYFSYIERPAALDFDVIPKRITGNSSPTPKGAHHFMMLDNFVLCYVVAVP |
| Ga0207646_100134156 | F006137 | AGGA | MPDNVGRFRWQKNGETSAADLLRECGEKLTDRILWTKFQERFQGLIFLYLMRALRIRRIQDDVSGIVPDLAQDVYMRLVQNDGRILRSFRGTTEFSVMAFLARISSSVVQDYLRQQSSEKRRAQVIPIETAKNGEITAFRPVESPEFDPNSISSILAWIDIERIVEGDPDRKNARRNALIFKLHYIDGFEAGEIAKFPGFDLSKSGVETILARLRKRIQK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |