NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207646_10076050

Scaffold Ga0207646_10076050


Overview

Basic Information
Taxon OID3300025922 Open in IMG/M
Scaffold IDGa0207646_10076050 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3000
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005385Metagenome / Metatranscriptome402Y
F006213Metagenome / Metatranscriptome378N
F007968Metagenome / Metatranscriptome341N

Sequences

Protein IDFamilyRBSSequence
Ga0207646_100760502F005385N/AVRYKYHYYRWINTKDYGSFKDMYEKYKDKGYTWWCADLPPQFSNQDGTWTGYRLDGDKTHTASTLKRYGRHKCWVDPQYKFEGKPVMLVYNASQ
Ga0207646_100760503F007968AGGAMRYILTVDFEDDVDIESFMHFVAYHTKRLKCASKDVFIRLAHEWEKQLVNPHEPTNSNGVKKEKKKTLKETNE
Ga0207646_100760505F006213GGAGMRGMPHTVKVERHQNELVVHVALLHGPEARLPGGVLLHTEGWVDIGYGLKMYLVIGSGNITYHPKEIEEKKGLLQRLFPKKQPQPLLEAK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.