NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207687_10002519

Scaffold Ga0207687_10002519


Overview

Basic Information
Taxon OID3300025927 Open in IMG/M
Scaffold IDGa0207687_10002519 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12427
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (64.29%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002324Metagenome571Y
F013826Metagenome / Metatranscriptome268Y

Sequences

Protein IDFamilyRBSSequence
Ga0207687_1000251910F002324GGAGGMGEIKLFQICYEGELTLGVSQAMRRLGAEPNFDQSWQVWLPEGRHSAALVRYLRANLGDDSRLLVGCMQFTTTRDFLLIRHSLTIDADYSELHDAIGRLGDVIPLPFESTFIVQSDDRTDAQTLGRALGELCPDDSLMVAGISHDWAFCNEGSSRMYVVADEENKYPQFRPF
Ga0207687_1000251913F013826N/AMAVCWQCPICNQVSCEDDANAAGRPLACDNCERALLPVETLCAVCESPNPWSRRDSVHYICRECGNSQTFYSHLAAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.