NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207664_10209187

Scaffold Ga0207664_10209187


Overview

Basic Information
Taxon OID3300025929 Open in IMG/M
Scaffold IDGa0207664_10209187 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1687
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.4774Long. (o)-85.451Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011126Metagenome / Metatranscriptome295Y
F024158Metagenome / Metatranscriptome207Y
F025552Metagenome / Metatranscriptome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0207664_102091873F024158AGGAMREHDVSALTARELERARRELAASLALTRPGSLARVPILATMNAIDTELAQRDYGQD
Ga0207664_102091874F011126AGGVPGTVAVPKHPVSALTTFELRDYRRDLERAIRGIAEDAPVQADLRRKLGAVIAEQEDRARMAADARA
Ga0207664_102091875F025552N/AGTWEHSPGRARRKDTAVPDIAEMDSYAMLCEDWGSAYQITRAPGQDHPYRAERRDDPAVVLTADGPGALRALIRADYLARPVPREVAP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.