NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207644_10000852

Scaffold Ga0207644_10000852


Overview

Basic Information
Taxon OID3300025931 Open in IMG/M
Scaffold IDGa0207644_10000852 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19325
Total Scaffold Genes27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)22 (81.48%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005075Metagenome / Metatranscriptome413Y
F028577Metagenome191Y

Sequences

Protein IDFamilyRBSSequence
Ga0207644_1000085223F028577GAGGMGSFKVAIVKRGKEALWRDYWINSLKEGTADDAPSGLGRTEVVEAESLNEAINAIQVRHPDCTVMLAGGEHHKA
Ga0207644_1000085226F005075AGGALVALTMYEAANILGALSAILLLMALVAWVKLIGGPLMQRTDGHIGMDPAQGEFASELLFWAAGLSSAAVISAIAGLMFA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.