NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207644_10723645

Scaffold Ga0207644_10723645


Overview

Basic Information
Taxon OID3300025931 Open in IMG/M
Scaffold IDGa0207644_10723645 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)830
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000667Metagenome / Metatranscriptome949Y
F015101Metagenome257Y

Sequences

Protein IDFamilyRBSSequence
Ga0207644_107236451F015101GGAGMAIKGWVVHKVNRLFTRVDLPPRATPLGQAVMRGKRETDARGGAADSLPRPQHLGAYAPLVAAIREELEQFVASHVRMHLAIAEHDRYLLTSIEVACEGDAERDLLRHFVREFKPRQIKTYIEKEVIGRLPNANAIDLAHFGGLNTAPVEGDGAPDEAYGELLAELRSSEPR
Ga0207644_107236452F000667N/ADAEIEAPLIWTFDGPYATCLADMEDTFRRAIIQVGDVSRIAVQIDLSLPALKPRIDAGETIQPAWGDFVDRLTTRYGLPASPRVRHLKMAGPLATMVIAYRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.