NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207686_10001191

Scaffold Ga0207686_10001191


Overview

Basic Information
Taxon OID3300025934 Open in IMG/M
Scaffold IDGa0207686_10001191 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15072
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (93.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007132Metagenome / Metatranscriptome357Y
F026373Metagenome / Metatranscriptome198Y
F064021Metagenome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0207686_1000119112F064021AGGMKKVLLAISVAALALTGCMSAMNTVLPPGRMSEAGEIRPCHRDYRDAQACGNALFNETVIDQIHTGQTLTDVRAIMRHDAERRTVAGSIESWGYITNYTDKVMTWIAFTDQKVSSVTQEPWVRD
Ga0207686_100011912F026373AGGAGMISTQSFDEIRVYAGVAERTGAHFERDTVRRSATFCRSLSELMRKVRASGDGVFYLPVKIWPADAERVDVTKRWLVLSSLPVA
Ga0207686_100011916F007132AGGAGMSRQTVRMTAGKVLRSEDLIADEKEVAAGILLANPDFGNPHVVRCPWCHETRTLFRDENEGPFTLTAHGWLCESCDVRAASQEVKF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.