 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300025936 Open in IMG/M |
| Scaffold ID | Ga0207670_10134735 Open in IMG/M |
| Source Dataset Name | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1814 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan, Kellogg Biological Station | |||||||
| Coordinates | Lat. (o) | 42.3948 | Long. (o) | -85.3738 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005849 | Metagenome | 388 | Y |
| F058236 | Metagenome | 135 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207670_101347351 | F005849 | N/A | TWGKPKVLLEDPRFNRNYDFVFYGFKTALFGDVPAFEAEAAKLDRTLTHLEQDYESITIVTHSKGGLLAMRTLLNRAQDFPGKQPYKIHRIVMFTPLTENVSLAQLPEFVKLLGKQSPDIAQMQADTYSELGRVKEDVKTLLNPQDPIAEQRREAFMKNVAEHLYVINAERDEIVDVGPNGEKIVSEGMRKLGELPTLGVPRLATLRYIDIGGKEEDARETKSGVRDPSYAHGMVVKIGAQDGFSFTNHFEELLFDRIGVPPRSFAGNAEQIRQNTHNQIQEQIFEMNKFVVEKNPMVGLAWKDINEAVQAKFKDVPEPSRTKQMEDLTKQTYYVYIFLDLYARMDDLRSRGILSPNDDMIVTWKRSWLPNLMRSELGRWMLESNLMEYYSETMIKDLRDAAAPAPANATAQASSQIGTH |
| Ga0207670_101347352 | F058236 | AGG | MDYNKLPAGSLVSDQMTRGWLGLTDSGWFCEEPHYKGTLLHLRHNVFQAKDVIVFVHGFTGDYVGAWGKPKVLLDDPRFNRNYDFVFCGDEKALYGDVAAFEEGARRLDGLLSHLEENYKTIT |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |