NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207669_10262912

Scaffold Ga0207669_10262912


Overview

Basic Information
Taxon OID3300025937 Open in IMG/M
Scaffold IDGa0207669_10262912 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1292
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001698Metagenome / Metatranscriptome650Y
F006575Metagenome / Metatranscriptome370Y
F057529Metagenome / Metatranscriptome136Y

Sequences

Protein IDFamilyRBSSequence
Ga0207669_102629121F001698AGGAGMAGVVNDIEALTEFRAHLRRFNHDLAENFATIQGHWRELGEIWRDDMYRLFGEALEEVTPGIATYLSATEGHEAHLAALIERLSGYLETGAGA
Ga0207669_102629122F006575GGAGMIIEPATATSEPATATSPYLNLRQAVRPAILAHRLLAGDQERAGTLAAECEDLLDLTGELLKATGRARILAVVPGPRMPDESGGDRQAQLFEAYAEAGLLWAKVVGSSLALAGALIERGEWEDVRALAGFLAGAGEESAATELRIRLGGAVWEEHREHLRTISNNMPPAAIELAINALRAILREVPEEFPDRNREVNCFLPPLASAVYAIMQKQEAEIPYHSRVEHIATGGVAKYPDIVKTSLDELAAEFDGICRRPGEPTT
Ga0207669_102629123F057529N/ALRAVLRVLSPAESDALLGVSAAASLDDDRALYRDTEWPVEQVEKFKPYSTASLYAFAREGFLSTNGKRSPA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.