NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207689_10347761

Scaffold Ga0207689_10347761


Overview

Basic Information
Taxon OID3300025942 Open in IMG/M
Scaffold IDGa0207689_10347761 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1232
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002416Metagenome561Y
F032806Metagenome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0207689_103477611F002416GGAGMNHLIQSINAPALSNSCAARIGRRLVTIGFGLKAAHGLVAVMLSIALGLVSVSAQTPSGQFFNGDSAQLGNSLRSVTFFLAAAMIIAGIIFIAVGIITSGLRESLSTWKFITGAACFAFGGVCAAIYAFSQGETVPVDNQF
Ga0207689_103477612F032806GGAGMRARPVRPNIYFPVVRFGVADSDWFSVLLISCICYLAPVPFGITLLYVPLQMWTWLLATAGAIAFFNYIRIGRKPYWLQHQLKALFSNHRQHRFIPNSRKSKFDRLWITDQQEDGRSPPKTSVTISSFLLQHNNSMREECEEKWNSVWPTTN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.