NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207712_10608572

Scaffold Ga0207712_10608572


Overview

Basic Information
Taxon OID3300025961 Open in IMG/M
Scaffold IDGa0207712_10608572 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)946
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameMichigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002416Metagenome561Y
F032806Metagenome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0207712_106085722F032806GGAGMRARPVRPNIYLPVVRFGVADSDWFSVLLISCICYLAPVPFGITLLYVPLQMWTWLLATAGAIAFFNYIRIGRKPYWLQHQLKALFSNHRQYRFIPNSRKSKFDRLWITDQQENGRSPPKTSVTISSFLLQHNNSVQEECEEKWNSVWPTTN
Ga0207712_106085723F002416N/ARRLVAIGFGLKAAYGVVAVILSILLGVMSVSAQTPSGQFFNGDSAQLGNSLRSVTFFLAAAMIIAGIIFIAVGIITSGLRESLSTWKFITGAACFAFGGVCAAIYAFSQGETVPVDNQF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.