NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207678_10212180

Scaffold Ga0207678_10212180


Overview

Basic Information
Taxon OID3300026067 Open in IMG/M
Scaffold IDGa0207678_10212180 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1656
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002023Metagenome / Metatranscriptome603Y
F005075Metagenome / Metatranscriptome413Y

Sequences

Protein IDFamilyRBSSequence
Ga0207678_102121801F002023GGAGMTQSVLLVAVTALLTWIVMRSVRSRTADPKRLSAQESEAERAKEVGSQLDGARDRASVVEVERNKLALAKAVKAALWVTDARLNAAVPELLKMAQLWAGKSSVRGMKWTAPKGVTDIEGLDNSAAAWASWRFDGHHWRIEGQWQPSTLPEEIEGDVGTFKVLVDRQLVLDMTISTEDPQLLWVDALTVGPWVSELLAFAGARTSDAKARSSARSARKNQNRADNIHWS
Ga0207678_102121803F005075N/AMVEAANVLGVLAAVLLLGSVIAWVKLIRGPLLQRTDGSTGTDSAQGELASELLFWAAGLSTAAAFLAIAGWIFI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.