NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207676_10000015

Scaffold Ga0207676_10000015


Overview

Basic Information
Taxon OID3300026095 Open in IMG/M
Scaffold IDGa0207676_10000015 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)329100
Total Scaffold Genes330 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)197 (59.70%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002324Metagenome571Y
F013826Metagenome / Metatranscriptome268Y
F025120Metagenome / Metatranscriptome203Y

Sequences

Protein IDFamilyRBSSequence
Ga0207676_10000015160F002324GGAGGMGEIKLFQICYEGDLTLEVSQTMRRLGAEPNFDQSWQVWLPEGRHSAALVRYLRSHLGHDARLLVACAQFTTARDFLLVRHSLTPGADYSELQEAMEYLGMIVPLPFESTFVIQSDDRTDVQTLGAALAELCPDESLMINGVSHDWAYCNAGTSQMYVADAMEELTFRTF
Ga0207676_10000015161F013826N/AMAVCWRCPRCGEVSCEDDANAEGRALACDHCERPFLPAETQCTVCDAPNPWSRRDSQHFWCRECGNTQTFYGFSGQADATISPSHQT
Ga0207676_10000015245F025120N/AVSGKRLVIGLIVMGVALPLTLFYLLALQTLSQLFTIAVSTFLTWGVTDFLANILHRPRLQNRTPGGAIREDWERRQKDS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.