NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209953_1000777

Scaffold Ga0209953_1000777


Overview

Basic Information
Taxon OID3300026097 Open in IMG/M
Scaffold IDGa0209953_1000777 Open in IMG/M
Source Dataset NameSalt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10940
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (94.44%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Microbacterium phage Shocker(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location
Location NameSouth San Francisco, USA
CoordinatesLat. (o)37.4958Long. (o)-122.1331Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031446Metagenome / Metatranscriptome182Y
F043342Metagenome / Metatranscriptome156Y
F103043Metagenome101N

Sequences

Protein IDFamilyRBSSequence
Ga0209953_100077712F103043AGGAGMSKPKDTLVLFTLAIANTSLTANDIAFRSGVSYNTVKKIVEADERVSSVGKHPTRYYMATPDVLDEQVIRLTGDAPREGWVEWVAKVSPKLAQFVRLDKTALSEDVRKQGMVLEALGTNLIFMGRQLQEHSEKPEWFTLMGGDEND
Ga0209953_10007773F043342AGGAMDATTELREFYNYIWGEEAVTETPTFVYLPVEHESKWTPYMFEWPRQREGVIRHTLKWSAIQANVFYSPALFKAANPAKDNVLGSWMLWVDFDGNAPQEWGQEAEEGKMFVPPPTLIVQSSIEGHEHCYWKLDKFVDDIEMLEDRNRALAYVMHADTSGWDADQILRPIRTTNHKRNMPVIVKEWEREDRV
Ga0209953_10007778F031446GGAGMDDDDLWLVENFKLYEPHQDDYTVIEVESRGVGRPMSEPSEITDIVSTGRKRAAMMYPIFKDMKCEWANLRSAGGGVEPIIGCPGHVIQPTKGPDKGDRHHGPDKNVINNAPDNVHRICSTCHNRWHALNNKYYGPRPPADEPFIPLEEYICKKHDPETKATDKEIADNETWWATKHKLLANVDTE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.