NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208317_1003010

Scaffold Ga0208317_1003010


Overview

Basic Information
Taxon OID3300026117 Open in IMG/M
Scaffold IDGa0208317_1003010 Open in IMG/M
Source Dataset NameMarine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)796
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)1.4995Long. (o)-36.9978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049037Metagenome / Metatranscriptome147N
F060975Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0208317_10030101F049037N/AGKITHHDRSPNWYIDLPPYTITVRELSERCGFGKETNKLKHWLGLKVFKLIEDPLGFYFLRHLDGAIEDLHEGKSSKRLRYAKAACSQVVLEAKARESTARSQDNVGAVVRRKMGRTITTVRSDEDSSEEKQGKWGKLSEIIW
Ga0208317_10030102F060975AGGAGMGKTIRNNLVAKHSEKFNKPKTVRDKKKDYYRPDVKRDFEEAIEDMGFDEHNKKDAIIAQYQDDLARSQEDGWPYED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.