NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209955_1019386

Scaffold Ga0209955_1019386


Overview

Basic Information
Taxon OID3300026123 Open in IMG/M
Scaffold IDGa0209955_1019386 Open in IMG/M
Source Dataset NameWater microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1573
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location
Location NameSouth San Francisco, USA
CoordinatesLat. (o)37.4962Long. (o)-122.1329Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071133Metagenome / Metatranscriptome122N
F094928Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0209955_10193861F071133GAGGMSMQKSYCKQMRYSGPESLPPSDAYKFDVLIQMEVLSGCQQACLGCFVDKNIDPAMNQQIIDRAKELTDGIKRTGLNLREFVIGPTDFFTASNTKAVLNNPTVQEIMREHTGARIAAPAKFDVATMERVQEIFNI
Ga0209955_10193862F094928AGGAGMVMSRADVNSWVQAYGGAQLRSFDRTATIRVNAYVRGTIGNYGNRYHPVWSSYTTGANYYHRFEYVGAPNSVYNNYVDSGINTGNIIYPQDIVDTLEDLTRRTVDLIEGRMSNRYISALYCHASCHSSCHSSRGRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.