Basic Information | |
---|---|
Taxon OID | 3300026130 Open in IMG/M |
Scaffold ID | Ga0209961_1025484 Open in IMG/M |
Source Dataset Name | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1292 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration. |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South San Francisco, USA | |||||||
Coordinates | Lat. (o) | 37.496 | Long. (o) | -122.1329 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F012221 | Metagenome / Metatranscriptome | 282 | Y |
F104070 | Metagenome / Metatranscriptome | 101 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209961_10254841 | F104070 | N/A | FLMIGAALNSLNIYPWGPIANLFGGMTWLIVSIMWREAALITTNIVLATITFIGLVYTYT |
Ga0209961_10254844 | F012221 | N/A | TKKKEVKFDFTFEECDFSAETFKNAIIYSKSGFGPRMGFKASTSGFGVYLEGRFKGAGSQVGAIDATKIPEEIKKRYNYTIRKGGTPDLKVEEPIALKEMKEMIKRHGAKKISNGLDSYKHFLELYDKAPLFQKQRFCRISSFMYPYLELSFDKGDDKEFKDLMSWSYSLAKKETDVGGFYIFLGP |
⦗Top⦘ |