NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207985_1013023

Scaffold Ga0207985_1013023


Overview

Basic Information
Taxon OID3300026203 Open in IMG/M
Scaffold IDGa0207985_1013023 Open in IMG/M
Source Dataset NameMarine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2236
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location
Location NamePacific Ocean: Eastern Tropical North Pacific
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000613Metagenome / Metatranscriptome985Y
F002192Metagenome / Metatranscriptome585Y
F036730Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0207985_10130231F036730AGGAGGLAEEFVIKSSLIEDKINQLLPSQGGFQPGVDFSASTMVIPIVDLTETAEGSVLREDLQKSLSL
Ga0207985_10130232F000613AGGAGMPLVKKKVSIAAGAVSDQILAGTTYEYVDPGTRIVVAAAVDTAGTATADTTMDFTVNNAEFAKDASVSTIVSGQPFGWNGTGYVLNDMVTTGQVRNRPIIQFKNGTAGTRTVDVAVFIGG
Ga0207985_10130234F002192N/AMDHLLLYSSLFIAVLALFFGLYACGRVAKINQATKDLEWDAIANITGDLATTKKTIQTLNNRINGMHSPKVAEQELLMQLMQNKQNSNPNGKIIGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.