NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209750_1007138

Scaffold Ga0209750_1007138


Overview

Basic Information
Taxon OID3300026237 Open in IMG/M
Scaffold IDGa0209750_1007138 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2945
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004307Metagenome / Metatranscriptome444Y
F005028Metagenome / Metatranscriptome414Y
F076715Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
Ga0209750_10071383F076715AGGAMWWKIEEVPAQELEEWERALVRCENRAKRDLEARAAGVFVIFVREGETRPEYAPGDKAPEGAYLVGKWTLKPQKGWMWYE
Ga0209750_10071384F005028GAGGMRDDDLRAAMSFFAARLRGAELDETRLLRWTRHKLRSDAQAVAELMLTVGYRPTFIRYFLRYHIPALRESAAVGETYTDPDAAAEAHLGLCWRLDEDVLTVYSDLHAAAKRLRQPYRDLAAVCLRWGYVHETVVQMLAKVLERKPQNVVED
Ga0209750_10071386F004307AGGAMFKELISNGKDGHERPELNGAYIGRFLGVKERQRPTFETRHNPEPTLEDVFVFEFEVEDDDGNPLRVSKWVRKPKRLTHPNGGKVTNLYKTLAALYGVSVMTDEQLERAEEFIQEVVGREYQLTIETKPSGWYEIVHIAPVRARLRKTKEDEVPF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.