NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209350_1007620

Scaffold Ga0209350_1007620


Overview

Basic Information
Taxon OID3300026277 Open in IMG/M
Scaffold IDGa0209350_1007620 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3631
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.73825Long. (o)-123.6301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000321Metagenome / Metatranscriptome1304Y
F021825Metagenome / Metatranscriptome217Y
F105673Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0209350_10076204F105673AGGAGMQCRRIIGERDGYWNIKGWGHFVADSWLNCLHFLRFAWYHFEQKVVPLRCRS
Ga0209350_10076205F021825N/AMKKDYQRCLDKLAATAPETKSALIRSLLPGIEAALNSGKRLKAIWEALREEGLQMSYHSFHKTVSRSRKVKKPTATSILGKQPKPSEARGLRETEVETVEERDPLANLKLLEENRPGFHWRSAKSLNALVHGTEDSNDKNKW
Ga0209350_10076208F000321GGAGVRLLSALDKLLRDKPRYMGELSTSINDALLAVDLNTVELVNLQSRQKQTGRETQVVILRRLRKLIHHVAQKRKCSMNQLVNSALLAYYSKTGEAKLKRPAKGRGGSRRTYDTMSELERRELHQMLSGLAAVQPLSADVEEPDGTYYEYDRNLKATVKVTPDGERTPVVQLEAQFARPPQKGSHKTAHEGMIP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.