NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209017_10021111

Scaffold Ga0209017_10021111


Overview

Basic Information
Taxon OID3300026280 Open in IMG/M
Scaffold IDGa0209017_10021111 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1888
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002372Metagenome / Metatranscriptome566Y
F002795Metagenome / Metatranscriptome529Y
F008135Metagenome / Metatranscriptome338Y
F098761Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0209017_100211111F098761N/ADVRLRRLTQYVYVTAGRFRRSGVDYAVYRWHEHPYADDVLVERYRFALRLSDWYGVYDTLYGAAAGDTLAILPAPAPAPALAPARRRG
Ga0209017_100211113F008135N/AMRAMNDPRTERLLVSAGTSIARVLDDRQRHAVALALEVCRYIVAALPPDDELTFGDVVRLLRWFVTGFREADDAGD
Ga0209017_100211114F002795GGAGGMPVTSGLVLRGMVAAYREFVSRKDGRLFRVVTVFGDLMVGEVVLCAVDGYDVFVDTPGYARGETVELPARLQFLRDGSGRPVIRLYVDEGVR
Ga0209017_100211115F002372AGGGGGMMPTRREDALWSVVHRRSSHLRALLDALDDVDMSIAYELHYYPYAIVELLRVRDDAPPIVLRSTYVSANRQWERHSEFTLRVVEAALQLVQEYRADPSLGGSDSWA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.