NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209017_10052597

Scaffold Ga0209017_10052597


Overview

Basic Information
Taxon OID3300026280 Open in IMG/M
Scaffold IDGa0209017_10052597 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)910
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002229Metagenome / Metatranscriptome580Y
F002372Metagenome / Metatranscriptome566Y
F002795Metagenome / Metatranscriptome529Y

Sequences

Protein IDFamilyRBSSequence
Ga0209017_100525971F002229N/AYGVVEVDMVTLLTLDGVEDVDYVPSDLEIRASLDDSGLYGMVLGSVTWMRLSSGAGWWTVIGGRRVTATLAAIGWCWVADGLGARGYWSPTLACIPGEVRALCGGCAEDEDEEAGDGDE
Ga0209017_100525972F002795AGGAGGMVTNSGLILRGMVASYREFISRKDGKTYRVATVFGDLMAGETVLCQVDGYDVFVDSSYARGEMVELPARMQFLRDGSGRPVIKLYVDEGVR
Ga0209017_100525973F002372AGGGGGMPTRREDALWQIVHRKSSHLRALLDSLDLVDVGVTYELDFYPYAIVELLRVREDAPPLVLRSVYVQANRQWEYHSEFALRVVEAALQLVHEYRAD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.