NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209227_1007030

Scaffold Ga0209227_1007030


Overview

Basic Information
Taxon OID3300026293 Open in IMG/M
Scaffold IDGa0209227_1007030 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant NP 2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6277
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002229Metagenome / Metatranscriptome580Y
F002795Metagenome / Metatranscriptome529Y
F004024Metagenome / Metatranscriptome456N

Sequences

Protein IDFamilyRBSSequence
Ga0209227_10070301F004024GGAGGMQSERDYVRQSSLGDDDMMFLDARATLATALARAVVGYSDNRVRALAWLAVATPRLYDRIAPIVESSAIRQSPGAARALRDALRALSLEDYMRRRDERRSER
Ga0209227_10070303F002229GGAGGMVTLLTADGVEEIDYLPSDAEIRTSLDDAGLYGMVVDGVTWIRLSSGVGWWTVLAGRRVAATLAALGWCWVTDDGRGYWSPTLASVASEACAMLGVEVDDGD
Ga0209227_10070304F002795GGAGGMATSGLTLRGMVASYREFASRRDGRTYRVITVFGDLVLDGVILCQVDGYDVFVDSPGYTRGEMVELPARLQFVRDSSGRPAVRLYVDEGVR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.