NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209235_1002199

Scaffold Ga0209235_1002199


Overview

Basic Information
Taxon OID3300026296 Open in IMG/M
Scaffold IDGa0209235_1002199 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10834
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.718176Long. (o)-123.652732Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005263Metagenome / Metatranscriptome406Y
F030030Metagenome / Metatranscriptome186Y
F042845Metagenome / Metatranscriptome157Y
F046962Metagenome / Metatranscriptome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0209235_100219912F005263N/ALERRTRRTFTIDPDVSEKIDKMVGGHNLEVNVLVNKAIRRYIEWGRYVDSFKLVTSDPRLMKTLWSHVTVGEAREMGTKNGKDTVVEFILYYFRKFDLDSVLKTFEVVGAEYANAYVYSEFGDKENRTIILRHSMGLSASAYYGASFKALCDRLGMKCELEESEDQMTCKISSASVLKTIAPKTLKEQLAKQSIETSRIVGLPAG
Ga0209235_10021997F030030N/AMSIGENAYDILSNEAKNRDVTVQQLLRAVVVPDWIKQNSNGQPIGENDSNLLQPSIYGGESRNSRALISPVARLRH
Ga0209235_10021998F042845AGAAGGMENRKWKAFLRMTGETTVAGEDILTEFKAMVEYLKWIGVDYSMVVQVEAGETDPSRILALEQTPRRREPGQLGD
Ga0209235_10021999F046962N/ALEETANVGYPPETPSQTVPQDTMTDDQLKDLLAELISSSASLNVRVWLDGVYTDIENAGTHREWMKGREVYFKVEGKVDGQNSPEEAVSRRA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.