Scaffold Ga0209235_1026555

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209235_1026555

Scaffold Ga0209235_1026555

Overview

Basic Information
Taxon OID	3300026296 Open in IMG/M
Scaffold ID	Ga0209235_1026555 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3035
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location Name	Angelo Coastal Reserve, California, USA
Coordinates	Lat. (^o)	39.718176	Long. (^o)	-123.652732	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020655	Metagenome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209235_10265556	F020655	GAG	VFVLAGALVTLVLGVSTPVRAAGPTLRIVSPADHAVIGNGSSVPVIFVVSGFNLTPPGTGGPGPSPTEGHVDVYVDGVLTIAVSQETIDLLLASGTYTILLRLVSDNGTALSPDVTSSISVTVTQGPAVGTPRIEISYVEIMYPTPGLVLGRDVTISFRITDFALVPPGRGESVPNEGHVAVFLDGVYYMAVMVFRPIPFSDLVDGEHTVMVRLVDDAGQALTPDASDSVTFRIQFAAIVDINPYLSITQIVLAGAIFVVLFYRRLGRNLLATLSARLGGKNA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.