NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209237_1014979

Scaffold Ga0209237_1014979


Overview

Basic Information
Taxon OID3300026297 Open in IMG/M
Scaffold IDGa0209237_1014979 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4554
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.73825Long. (o)-123.6301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008075Metagenome / Metatranscriptome339N
F013400Metagenome / Metatranscriptome271N

Sequences

Protein IDFamilyRBSSequence
Ga0209237_10149791F013400AGGAGMTDATLLTGMWIFAVLQVILEAGIVLYAYRLTRLTGSFRAWTMIILAFILTTASSLFGIILLLINPDLIAGLVQSISLPTLIVSYAVSIATSLLFFFGVFDLVRRFKLAAKKPPGAGSST
Ga0209237_10149794F008075AGCAGGMRQSPGFANVFEASVAEGLANTLGAIVMQTLKSVLSYSFEAYAEKPSELHRELSRVFGSGATTLERMITNELFRRLDLQYSNELDFEASVNLARRDMVISERGNN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.