NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209236_1046514

Scaffold Ga0209236_1046514


Overview

Basic Information
Taxon OID3300026298 Open in IMG/M
Scaffold IDGa0209236_1046514 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2195
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.718176Long. (o)-123.652732Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004205Metagenome / Metatranscriptome448Y
F006201Metagenome / Metatranscriptome379Y
F052533Metagenome / Metatranscriptome142N

Sequences

Protein IDFamilyRBSSequence
Ga0209236_10465142F006201AGGAGGMRPEQKTLLTSALEALGPERVTRGLEATGHTWNDCFLAIALYGAPAALARQLQKRWRREHFVGTLLGVRMQVVNEVVRAWDHEEGTFRALAAEWLELNRSRVPTGPVVSA
Ga0209236_10465143F004205GGAGGMEARVTSQSQPFRLMERMDEAKVFHGQEVRADLPNVRVTALAGSAEGQALFCNLGPIRVREIVHRGDDGPLPTNVTLEGLEVSISGTYDILNALVSANGDLRLVVDDKARVVPAARLVDAALGYRVAMGG
Ga0209236_10465144F052533GGAGGMSEIKSKAEAHEWILTHVRQRPGCQDFSQQFRLLGKGPKWECIPTNCYDWDRASLEAFDQVVGEARRRFELEG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.