NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209238_1000875

Scaffold Ga0209238_1000875


Overview

Basic Information
Taxon OID3300026301 Open in IMG/M
Scaffold IDGa0209238_1000875 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11302
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (93.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.73825Long. (o)-123.6301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011834Metagenome286Y
F026533Metagenome / Metatranscriptome197N
F104892Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0209238_10008752F104892AGGMTTAFKNWHSLAVGAVLLAFSVFLTSTAFASLKTAQTALQGWAMLVIAGYAFVSAIFLGASPLSENSTLTESFPGVFDHFKSFLIGGLFYAIGNFLVTVEATSLGAPEQVLALAAALIVGGALTLVAVLVAVAAAFVRPRK
Ga0209238_10008753F026533AGGAGMPIEKKHLSKKDVQKFDPSPLYLYTAKDALNRVTVLKEANKDAYLIAGRYSGNDNENRLYTPLNEEENKEIEKLVRIGRKDATISFL
Ga0209238_10008755F011834GAGMVVEADFYRVRLRFKRLYADPMIFEDQKNAVRQFLKSPHLASNQVAIYQITDDISPSDNVGKSPDIAGTARYIHRGRVVRSEYLENANVTLEYADFGSGLSPDDHQRLWKRQRWGRMNFDLEEFHHEHLKIEMPAVPELYEMLRSRADPTTLVDVELPELSDNFFRSAVGYLEIRLKQLAELEHQMIDIYVARDLLPEEKAALEKRLTRPSTQSTIYIMLSKSEGTAHL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.