NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209240_1000212

Scaffold Ga0209240_1000212


Overview

Basic Information
Taxon OID3300026304 Open in IMG/M
Scaffold IDGa0209240_1000212 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23855
Total Scaffold Genes34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (55.88%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameLaytonville, California, USA
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005519Metagenome / Metatranscriptome398Y
F020988Metagenome / Metatranscriptome221Y

Sequences

Protein IDFamilyRBSSequence
Ga0209240_10002122F020988N/AMRGIGSKLERACALAIILCASALQVGLYAQQATKLSPKVMAVVNAPLVERKDDDPSLLRLKKERFNAALKEAKARFDLYNRGLTRIPELIAVSERLFGAEVDLYDKPEQKAEVLQRQLDVYIEAEANLQKQVSDGLATQADLERLRCNKFSIEIDLSNAKNRHGDHESKAQPTP
Ga0209240_100021228F005519GGAGGMRPVEFGEALAAGTRLTLFSDDKPDRFFTVIKFWMDETLGASLAPSSGVPSYQVEDEEGRTHLLIHLSIDEEHEYRWCLWRPDQAGFDSRSIFDGALLEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.