NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209055_1009454

Scaffold Ga0209055_1009454


Overview

Basic Information
Taxon OID3300026309 Open in IMG/M
Scaffold IDGa0209055_1009454 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5224
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (44.44%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003462Metagenome / Metatranscriptome485Y
F008395Metagenome / Metatranscriptome334Y

Sequences

Protein IDFamilyRBSSequence
Ga0209055_10094546F008395GGAMKSALLAAIFGITGGVAILLAVPAEEKAPVVKIIPPKWFPDYGDPVVPQIEEVPPQEVVVPEPLEHYSVAQAKTEKPAPRRHMHVVRPRPNFFEKLVGGFIKLQKHQATKYFVNGLEELRGAAE
Ga0209055_10094549F003462N/AAEFRITNLDVHVPSGLPVMWRGHKVSTGPLDFGLDDSTGISCGVMNYELGVVSSEFHALVRFRWFAVQLKALGIDADLMTPVHAVLKTEGEILPDHSFNGGLRGSCKVEPHKIFSSQGLRIEILPGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.