NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209239_1003999

Scaffold Ga0209239_1003999


Overview

Basic Information
Taxon OID3300026310 Open in IMG/M
Scaffold IDGa0209239_1003999 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8532
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameAngelo Coastal Reserve, California, USA
CoordinatesLat. (o)39.73825Long. (o)-123.6301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030030Metagenome / Metatranscriptome186Y
F042845Metagenome / Metatranscriptome157Y
F046962Metagenome / Metatranscriptome150Y
F061700Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0209239_100399911F061700N/AMCDKCHRFFVISYEKNEKGEVVEVGHELDIHVKSSGIVRVDEGEQRRGFERTPPARKYEEETCW
Ga0209239_10039997F046962GGAMEEMANSGYPSETTNRTIPQDTMTNDQLRNLLAELISSSASLNVRVWLDGVYTDIENAGAHREWMKGREVYFKVEGKVDGQNSLEEASHRSD
Ga0209239_10039998F042845AGGAGMETRKWKAFLRMSGETTVDSSPDILIEFKAMVKYLKSIGVDYSIVVQVEADQPERSQTLAMEQPPRRPETGQLGD
Ga0209239_10039999F030030AGGAGMAKFIMSIGDNAYDILSNEAKNRDVTVQQLLRAVVVPDWIKQNANGEPPIETRSHPIRSSVYGVDTSNSGMLVSPVARLRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.